PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LPERR04G01950.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Leersia
Family bZIP
Protein Properties Length: 554aa    MW: 60968.4 Da    PI: 8.1257
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LPERR04G01950.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_127.56.6e-09334392563
                      CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
           bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklksev 63 
                      kr +r   NR +A rs + K +++ eLe+kv++L+ eN +L  ++  ++k+ + l s++
  LPERR04G01950.1 334 KRVKRILNNRASAARSKLNKMKYTTELERKVQVLQRENATLCVQVTLMQKNNQGLLSQN 392
                      899************************************************99999987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003387.2E-12330394IPR004827Basic-leucine zipper domain
PROSITE profilePS502179.852332395IPR004827Basic-leucine zipper domain
PfamPF001701.4E-9334392IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1704.5E-9334391No hitNo description
SuperFamilySSF579593.25E-9334390No hitNo description
CDDcd147032.71E-20335386No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 554 aa     Download sequence    Send to blast
MKGKSLHGLS LLDGSDDGIL APMVPSQLSS ILNLVSHHRL NQSFHVSPAR FTSLTGSAFS  60
RYLEPPRLAP AVEVGNSFRS EQFFSLFPNS SFLKESIRSP PYVTVDVPPM IALVPQPTRS  120
NQGLRSKLPL MVGHRRWHRE ILLEDSLQSL QMPHLAPVKP EDRGRSTCTQ RGTHDTVMTL  180
SCVGHWVIFV LDSTLPADVV DGVMKDLGII ASTSNNVTQD WHEKIHSDPQ AWGPSDSREN  240
EAQSSDASNT THYCCNMSLD TFMTRTLNVG VVNLQMCNPL LPNTVAYAGG SESNVGGIVV  300
PFATEFGNVK FHEEEKKKIM ADKFLSEIVL ADPKRVKRIL NNRASAARSK LNKMKYTTEL  360
ERKVQVLQRE NATLCVQVTL MQKNNQGLLS QNNEMKIRLQ TMDQQAQSGN ALTEILTTEV  420
EQLKVIAGEI SSPDVPRGSY QPVISISSPP SQNPSHHFLP LLEPNIKGES SRCHSLLDGL  480
GDGIQAPTVP SHVSSIVNLI SHYRINQSSH PSPIHFTSLT GSLFSLLGTT TVGSYGNPSF  540
RLNKLLVTTV DFTK
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLA0A0D9W2D30.0A0A0D9W2D3_9ORYZ; Uncharacterized protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP147931112
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G38900.32e-39bZIP family protein